Informácie

Ako zosúladiť sekvencie štruktúr PDB prostredníctvom odkazov Uniprot?

Ako zosúladiť sekvencie štruktúr PDB prostredníctvom odkazov Uniprot?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Snažím sa zosúladiť štruktúry v záznamoch PDB s ich sekvenciami, ako je uvedené v nichchemList.polymer.dbrefzáznamy.

Napr .: zvažovanie štruktúr pre HIV integrázu:

PNR: 3OS0referencieUNP:P14350so zameraním na integrázu (len = 391)

>sp|P14350|752-1143 CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQ… NRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE

PNR: 2B4JreferencieUNP:P12497, so zameraním na integrázu (len = 287)

> sp | P12497 | 1148-1435 FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI… LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Prečo by tieto sekvencie mali byť také odlišné?!

a v prípade, že si myslíte, že som zameraný na trochu hluku: existujú 42 iné Integračné štruktúry HIV všetky odkazujúceUNP: P14350a 43 ďalších odkazovanie štruktúrUNP: 12497(a 79 ďalších odkazujúcichUNP: Q76353, veľmi podobnýUNP: 12497), 22 odvolávajúc sa na úplne inýUNP: Q72498.


Žiadny z nich nie je integrázou:

P12497 Proteín Gag-Pol polyproteín Gén gag-pol Organizmus Vírus ľudskej imunodeficiencie typu 1, skupina M podtyp B (izolát NY5) (HIV-1)
P14350 Proteín Pro-Pol polyproteín Génový organizmus Ľudský spumaretrovírus (SFVcpz (hu)) (ľudský penivý vírus)

Aj keď ste mali na mysli integrázový produkt polyproteínu, druhý nie je ani HIV.

Z Wikipedie:

Human Foamy Virus (HFV) je retrovírus a konkrétne patrí do rodov Spumavirus. Spumavírusy sú komplexné a niekoľkými spôsobmi sa výrazne líšia od ostatných šiestich rodov retrovírusov. Penové vírusy odvodzujú svoj názov od charakteristického „penivého“ vzhľadu cytopatického účinku (CPE) indukovaného v bunkách.[1]


Pozri si video: How to Get Gene Sequence from NCBI u0026 Ensembl (Septembra 2022).


Komentáre:

  1. Tulkree

    It is simply matchless phrase ;)

  2. Mukazahn

    This is a very valuable phrase.

  3. Ioakim

    I apologise, I can help nothing, but it is assured, that to you will help to find the correct decision. Do not despair.

  4. Cestmir

    the Authoritarian answer, oddly ...

  5. Tioboid

    Incomparable topic, I like it))))



Napíšte správu